SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010814 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010814
Domain Number 1 Region: 1445-1584
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.49e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000221
Further Details:      
 
Domain Number 2 Region: 244-348
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000572
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010814   Gene: ENSNLEG00000008848   Transcript: ENSNLET00000011343
Sequence length 1589
Comment pep:known_by_projection supercontig:Nleu1.0:GL397468.1:1587011:1691830:-1 gene:ENSNLEG00000008848 transcript:ENSNLET00000011343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDASGRAAAEGWRKMEAPPDGAADLVPLDRYDAARAKIAANLQWICAKAYGRDNIPEDL
RDPFYVDQYEQEHIKPPVIKLLLSSELYCHVCSLILKGDQVAALQGHQSVIQALSRKGIY
VMESDDTPVTESDLSRAPIKMSAHMAMVDALMMAYTVEMSVKKVVASVKCFSMFSALKEL
PYDLEDAMFWINKVNLKMREITEKEVKLKQQLLESPAHQKSPSKWYWKLVPVRYRREHLS
ARQSPYFPLLEDLMRDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSMADSLYNIRLLRE
FSNEYLNKCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAKT
VLHQKSSRPPVPISNATKRSFLGSPAAGTSADLQPPVQLPAEGCHRHYLHPEEPEYLGKG
TAAFSPSHPLLPLRQKQQKSIQGEDIPDQRHRSNSLTRVDGQPRGAAIAWPEKKTRPASQ
PTPFALHHAASCEVDPSSGDSISLARSISKDSLASSIVNLTPQNQPHPTATKTHGKSLLN
NVSIEDEEEELVAIVRADVAPQQADPEFPRASPRALGLTANARSPQGQLDTSESKPDSFF
LEPLMPAVLKPAKEKQVITKEDERGEGRPRSITSRKPSEGPQPLVRRKMTGSRDLNRTFT
PIPCSEFPMGIDPTETGPQSVETTGEVCGGPLALGGFDPFPQGLSTDGFFLHVGRADEDT
EGRLYVSCSKSPNSHDSEPWTLLRQDSDSDVVDIEEAEHDFMGEAHPVVLSRYIGEEESA
KLQEDMKVKEHEDKDDASGRSSPCLSTASQMSSVSMASGSVKMTSFAERKLQRLNSCETK
SSTSSSQKTTPDASESCPVPLKTWWQKREQSPGWHGRDHASLAELVQLHMQLEEKRRAIE
AQKKKMEALSARQRLKLGKAAFLHVVKKGKAEAAPPVRPEHFAKEYSQHNGEDCGDAXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAALLEDTVGEVVDVNECDLSIEKLNETIST
LQQAILKISQQQEQLLMKSPTVPVPGSKNNSQDHKVKVPVHFVEPLSPTGVAGHRKAPRL
GQGRNSRSGRPAELKVPKDRPQGSSRSKTPTPSVETLPHLRPFPASSHPRTPTDPGLDGA
LEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANILSEQMSLKEVLDASVKEAGPSSS
DVSGKESVPVEEPLRSRASLIEVDLSDLKAPDEDGELASLDGSADLVSEGDQKPGVGFFF
KDEQKAEDELAKKRAAFLLKQQRKAEEARVRKQQLEAEVELKRDEARRKAEEDRVRKEEE
KARRELIKQEYLRRKQQQILEEQGLGKPKSKPKKPRPKSVHREESCSDSGTKCSSTPDNL
SRTQSGSSLSLASAATTEPESVHSGGTPSQRVESMEALPILSRNPSRSTDRDWETASAAS
SLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILEELEKCDANHYI
ILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKNITKKMIDKLYKYSSDRKQFNLIPAKTM
SVSVDALTIHNHLWQPKRPAVPKKAQTRK
Download sequence
Identical sequences ENSNLEP00000010814 ENSNLEP00000010814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]