SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010821 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010821
Domain Number 1 Region: 614-874
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-80
Family Eukaryotic proteases 0.0000973
Further Details:      
 
Domain Number 2 Region: 280-382
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000562
Further Details:      
 
Domain Number 3 Region: 498-599
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000851
Further Details:      
 
Domain Number 4 Region: 387-487
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 167-270
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 6 Region: 99-170
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-16
Family Kringle modules 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010821   Gene: ENSNLEG00000008859   Transcript: ENSNLET00000011350
Sequence length 875
Comment pep:known_by_projection supercontig:Nleu1.0:GL397336.1:3963565:4042052:-1 gene:ENSNLEG00000008859 transcript:ENSNLET00000011350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLARFVLALELGALPEVVGFDSVLNDSLHHRPRHSPPTGPHYPYYLPTQQRPPRTRPPP
PLPRFPRPPRALPAQRPHALQAGHTPRPHPWGCPAGEPWVSVTDFGAPCLRWAEVPPFLE
RSPPANWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSIRLRGGKNEFE
GTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCR
GDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPIIRLVGGSSVHEGRVELYHAGQ
WGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCP
KSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELN
TYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHRED
VSIACYPGGEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVTCRQ
LGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVICD
YFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLL
CGATLLSSCWVLTAAHCFKRYGNSTRNYAIRVGDYHTLVPEEFEEEIGVQQIVIHREYRP
DSSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRT
LQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVV
YGVTSWGHGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences ENSNLEP00000010821 ENSNLEP00000010821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]