SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011044 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011044
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000314
Family Cgl1923-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011044   Gene: ENSNLEG00000009063   Transcript: ENSNLET00000011588
Sequence length 264
Comment pep:known_by_projection supercontig:Nleu1.0:GL397401.1:2087735:2109961:1 gene:ENSNLEG00000009063 transcript:ENSNLET00000011588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESAPDLAGFTLLMPAVSVGNVGQLTMDLIISTLNMSKIGYFYTDCLVPMVGNNP
YATAEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIV
LSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWQEMEKSRCIPEIDDSEFCIR
IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQIIKPLSDDPTA
SASRWKIPSSWRLLFGSGLPPALF
Download sequence
Identical sequences G1RCU5
ENSNLEP00000011044 XP_003276740.1.23891 ENSNLEP00000011044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]