SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011061 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011061
Domain Number 1 Region: 408-555,670-807
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.66e-51
Family Phosphate binding protein-like 0.000000000134
Further Details:      
 
Domain Number 2 Region: 21-205
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.11e-21
Family L-arabinose binding protein-like 0.0057
Further Details:      
 
Domain Number 3 Region: 343-403
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000572
Family L-arabinose binding protein-like 0.0084
Further Details:      
 
Domain Number 4 Region: 563-665,699-727
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000089
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011061   Gene: ENSNLEG00000009062   Transcript: ENSNLET00000011606
Sequence length 946
Comment pep:known_by_projection supercontig:Nleu1.0:GL397473.1:816701:845237:1 gene:ENSNLEG00000009062 transcript:ENSNLET00000011606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKSKKRNYENLDQLSYDNKRGPKVYMHGRARHPRLGSPGLGASATRATLWPS
RRAAGPSNEERQPAAGRRGQAGEGRRGGVGHRPCGAGRYHGVQGLASADLSVLGTGTREK
PELLSRQEKERGKEQGGAGEGASLRSLSYASSPRVLMSSKYADGVTGRVEFNEDGDRKFA
NYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFV
YVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLART
MNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEF
SKPFKYQGLILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVAVMLYLLDRFSPFGRFKV
NSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANL
AAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNY
ESAAEAIQAVRDNKLHAFIWDSVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNV
SLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIF
IEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFK
RRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
Download sequence
Identical sequences ENSNLEP00000011061 ENSNLEP00000011061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]