SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011213 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011213
Domain Number 1 Region: 235-328
Classification Level Classification E-value
Superfamily Immunoglobulin 4.39e-20
Family I set domains 0.0065
Further Details:      
 
Domain Number 2 Region: 340-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000367
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011213   Gene: ENSNLEG00000009209   Transcript: ENSNLET00000011766
Sequence length 603
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:7247857:7441087:-1 gene:ENSNLEG00000009209 transcript:ENSNLET00000011766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQVCCSALPPPPLEKGRCSSYSDSSSSSERSSSSSSSSSESGSSSRSSSNNSSISRPAA
PPEPRPQQQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQ
DQAYKAPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVIS
VGSCAPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKK
MKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKV
KVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYY
IEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKHLGFELKEAEELYQKRVLTITGIC
VALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADY
ISKNVPATDHVIRRATETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDS
QSGIMLSSVGTSKCNSPACVEARARRAAAYNLEERRRATAPPYHDSVDSLRDSPHSERSV
PTL
Download sequence
Identical sequences ENSNLEP00000011213 ENSNLEP00000011213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]