SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011214 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011214
Domain Number 1 Region: 25-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-19
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 2 Region: 146-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011214   Gene: ENSNLEG00000009204   Transcript: ENSNLET00000011767
Sequence length 388
Comment pep:known_by_projection supercontig:Nleu1.0:GL397295.1:18213412:18331331:-1 gene:ENSNLEG00000009204 transcript:ENSNLET00000011767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSARYNFTPDPDFKDLGALKPLPVCEFEMGGSEGIVESIQIMKEGKATASEAVDCKWY
IRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGSSSVEDLKAKFCSTVANDVMLRTGLG
VIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCHSNMCINNTLVCNGLQNCVYPWDENH
CKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIISVIVQIKQPRKKYVQRKSDFDQTVFQ
EVFEPPHYELCTLRGTGATADFADVADDFENYHKLRRSSSKCVHDHHCGSQLSSTKGSRS
NLSTRDASILTELPTQPGKPLIPPMNRRNILVMKHNYSQDAADACDIDEIEEVPTTSHRL
ARHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences XP_012361707.1.23891 XP_012361708.1.23891 ENSNLEP00000011214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]