SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011225 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011225
Domain Number 1 Region: 14-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011225
Domain Number - Region: 69-170
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0628
Family Neurotransmitter-gated ion-channel transmembrane pore 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011225   Gene: ENSNLEG00000009210   Transcript: ENSNLET00000011778
Sequence length 306
Comment pep:known_by_projection supercontig:Nleu1.0:GL397401.1:2623963:3060046:1 gene:ENSNLEG00000009210 transcript:ENSNLET00000011778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFN
SELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPSQSRRREDGLPQEGCLWPSD
SAASRPGASEIMHAPRSRDRFTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEP
PPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDIAMYSGGPCPPSSNSGISAS
TCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSRLQFQQNNAESTIVPIKGKDR
KPGNLV
Download sequence
Identical sequences M3ZC60
XP_003276750.1.23891 ENSNLEP00000011225 ENSNLEP00000011225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]