SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011233 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011233
Domain Number 1 Region: 22-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.83e-83
Family Carbonic anhydrase 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011233   Gene: ENSNLEG00000009215   Transcript: ENSNLET00000011786
Sequence length 312
Comment pep:known_by_projection supercontig:Nleu1.0:GL397361.1:2438378:2463918:1 gene:ENSNLEG00000009215 transcript:ENSNLET00000011786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALVLLLSLFLLGGQAQHGSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PALKGLNLTGYETQAGEFPMVNNGHTVQISLPSTMRMTAADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHVVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKFPGQRTTLTGLDIQDMLPKNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQGKGHGHHGRSQNPRVQPTS
TRHPLALGSLEA
Download sequence
Identical sequences G1RDD4
ENSNLEP00000011233 ENSNLEP00000011233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]