SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011260 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011260
Domain Number 1 Region: 141-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.99e-117
Family Transglutaminase core 0.00000000744
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily E set domains 1.61e-43
Family Transglutaminase N-terminal domain 0.0000825
Further Details:      
 
Domain Number 3 Region: 492-603
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.75e-26
Family Transglutaminase, two C-terminal domains 0.00031
Further Details:      
 
Domain Number 4 Region: 606-701
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.23e-24
Family Transglutaminase, two C-terminal domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011260   Gene: ENSNLEG00000009234   Transcript: ENSNLET00000011813
Sequence length 704
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:517789:553055:-1 gene:ENSNLEG00000009234 transcript:ENSNLET00000011813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIRVTKVDWQRSRNGAAHHTQEYPCPELVVRRGQSFSLTLELSRALDCEETLIFTVETGP
RASEALHTKAVFQTSELEQSEGWTAAKEAQMENTLTVSLASPPNAIVGRHLLSIRLSSHR
KHSNRRLGEFVLLFNPWCAEDDVFLASEEDKIXXXXXXXXXXXXXXEKHIRAQGWNYGQF
EEDILNICLSILDRSPSHQNNPATDVSCRHDPIYVTRVISAMVNSNNDRGVVQGQWQGKY
GSGTSPLHWRGSVAILQKWLKGRYKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNSAH
DTDQNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQEE
SEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSNTKKIGR
CISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVKRLFGVEASGRRTLIRRAGGRCLW
RDDLLEPATKPSIAGKFKVLEPPMLGHDLRLALCLANLTSRAQRVRVNLSGATILYTRKP
VAEILHESHAVRLGPQEEKRIPITVSYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEKDI
TLEDFITIQVLGPAVVGVAVTVEVTVVNPLLERVKDCALMVEGSGLLQEQLSIDVPTLEP
QERASVQFDITPSKSGPRQLQVDLVSPHFPDIKGFVIVHVATAK
Download sequence
Identical sequences ENSNLEP00000011260 ENSNLEP00000011260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]