SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011643 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011643
Domain Number 1 Region: 510-660
Classification Level Classification E-value
Superfamily EF-hand 1.73e-50
Family Osteonectin 0.00000203
Further Details:      
 
Domain Number 2 Region: 455-507
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000388
Family Ovomucoid domain III-like 0.00054
Further Details:      
 
Domain Number 3 Region: 428-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000409
Family Follistatin (FS) module N-terminal domain, FS-N 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011643   Gene: ENSNLEG00000009544   Transcript: ENSNLET00000012217
Sequence length 661
Comment pep:known_by_projection supercontig:Nleu1.0:GL397302.1:19522043:19579203:-1 gene:ENSNLEG00000009544 transcript:ENSNLET00000012217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTGLFFLCILGTAAAIPTNARLLSDHSKPTAETVAPDNTAIPSLRAEDEENEKETAVST
EDHSHHKAEKSSKSKEESHEQSAEQGKSSSQELGLKDQEDSDDDLRVNLEYAPTEGTLDI
KEDMSEPQEKKLSENTDFLAPGVSSFIDSNQQESITKREENQEQTRNYSHHQLNRSSKHS
QGLRDQGNQEQDPNISNGEEEEEKEPGEVDTHNDNQERKTELPREHADSKQEEDNTQSDD
ILEESDQPTQVSKMQEDEFDQGNQEQEDNSNAEMEEENASNVNKHIQETEWQSQEGKTGL
EAISNHKEIDEKTVSEALLMEPTDDGNTTPRNHGADDDGGDDGDDGDDGPRHSASDDYFI
PSQAFLEAERAQSIAYHLKIEEQREKAHENENIDTSEPGEHQEAKKAENSSNDEEMSSEG
NMRVRGVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKLLDQVCGTDNQTYASSC
HLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYEANS
EHAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELDQHP
MDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLL
F
Download sequence
Identical sequences ENSNLEP00000011643 ENSNLEP00000011643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]