SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011673 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011673
Domain Number 1 Region: 20-160
Classification Level Classification E-value
Superfamily Activator of Hsp90 ATPase, Aha1 1.7e-38
Family Activator of Hsp90 ATPase, Aha1 0.0019
Further Details:      
 
Domain Number 2 Region: 220-290
Classification Level Classification E-value
Superfamily Bet v1-like 0.00000165
Family AHSA1 domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011673   Gene: ENSNLEG00000009584   Transcript: ENSNLET00000012248
Sequence length 297
Comment pep:known_by_projection supercontig:Nleu1.0:GL397287.1:14248450:14258533:1 gene:ENSNLEG00000009584 transcript:ENSNLET00000012248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWGQGDPRWIVEEREDGTNVNNWHWTERDATSWSKGKFQELLVGIVVENDAGRGEISE
LKQVEGEASCSSHKGKLIFFYEWNIKLGWKGIVKESGVKKGLIEIPSLSEENEVDDTEVC
DQKKKGDGDILKDLIKTAGTAKVREALGDYLKALKTEFTTGILPTKAMATQELTVKRKLS
ENTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIFTVKDLTNKIIMKWRCRNWPG
EHYATVALNFVPTLGQTDLQLDCKGVPICKEENMKFCWQKQHFEEIKGLLQLTPLNG
Download sequence
Identical sequences ENSNLEP00000011673 ENSNLEP00000011673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]