SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011933 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011933
Domain Number 1 Region: 21-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.93e-90
Family Carbonic anhydrase 0.000000000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011933   Gene: ENSNLEG00000009787   Transcript: ENSNLET00000012516
Sequence length 337
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:1019311:1026589:1 gene:ENSNLEG00000009787 transcript:ENSNLET00000012516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPE
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPEG
SEHQINSEATVAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPPQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEGPSKLLVQNYRAPQPLNQRMVFASFIQGDSPRLRSEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Download sequence
Identical sequences ENSNLEP00000011933 ENSNLEP00000011933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]