SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011965 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011965
Domain Number 1 Region: 61-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011965
Domain Number - Region: 19-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00375
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011965   Gene: ENSNLEG00000009814   Transcript: ENSNLET00000012549
Sequence length 690
Comment pep:known_by_projection supercontig:Nleu1.0:GL397278.1:11718790:11826938:-1 gene:ENSNLEG00000009814 transcript:ENSNLET00000012549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLFPLLVVFSTLLNCSYTQNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDN
ECGNLTQSCGENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTICIENVNANCHLDNV
CIAANINKTLTKIRPIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYENNTI
SAKDTLSNSTLTEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSF
QKTTEFDTNSTDIALKVFFFDSYKMKHVHPHMNVDGDYINIFPKRKAAYDSNGNVAVAFL
YYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISPVISVSMSSNPPTLYELEKIIFTLSHR
KVTDRYRSLCAFWNYSPDTMNGSWSSEGCELSYSNETHTSCRCNHLTHFAILMSSGPSIG
TKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVG
INTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLS
PAVVVGFSAALGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHT
AGLKPEVSCFENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFI
FLFLCVLSRKIQEEYYRLFKNVPCCFGCLR
Download sequence
Identical sequences G1RFG5
XP_003260287.1.23891 ENSNLEP00000011965 ENSNLEP00000011965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]