SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012016 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012016
Domain Number 1 Region: 32-259
Classification Level Classification E-value
Superfamily Heme oxygenase-like 9.64e-74
Family Eukaryotic type heme oxygenase 0.000000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012016   Gene: ENSNLEG00000009857   Transcript: ENSNLET00000012601
Sequence length 316
Comment pep:known_by_projection supercontig:Nleu1.0:GL397322.1:4363926:4400800:1 gene:ENSNLEG00000009857 transcript:ENSNLET00000012601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTPFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCPKAAQKYVERIHYIGQNKPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKEGIVEEANKAFEYNMQIFNELDQA
GSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
AAGVALAAGLLAWYYM
Download sequence
Identical sequences G1RFL6
ENSNLEP00000012016 XP_003269274.1.23891 XP_003269275.1.23891 XP_003269276.1.23891 XP_004091323.1.23891 XP_012352740.1.23891 XP_012352741.1.23891 ENSNLEP00000012016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]