SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012131 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012131
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 7.32e-59
Family Ran-binding protein mog1p 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012131   Gene: ENSNLEG00000009957   Transcript: ENSNLET00000012726
Sequence length 186
Comment pep:known_by_projection supercontig:Nleu1.0:GL397365.1:3290075:3293562:1 gene:ENSNLEG00000009957 transcript:ENSNLET00000012726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTRDCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRG
EAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGCCQEAWVLSGRQQIAKENQQVAK
DVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDP
NIFGPQ
Download sequence
Identical sequences A0A2I3GLJ3
ENSNLEP00000012131 ENSNLEP00000012131 XP_003274696.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]