SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012186 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000012186
Domain Number - Region: 366-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Integrin beta EGF-like domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012186   Gene: ENSNLEG00000009994   Transcript: ENSNLET00000012782
Sequence length 515
Comment pep:known_by_projection supercontig:Nleu1.0:GL397322.1:4929156:4938343:-1 gene:ENSNLEG00000009994 transcript:ENSNLET00000012782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSTGRWLLLRLALFGFLLEASGGLDSGASRDDDLLLPYPRARARLPRDCTRVRAGRRE
HESWPPPPATPGAGGLAVRTFVSHFRDRAVAGHLTRAVEPLRTFSVLEPGGPGGCAARRR
ATVEETARAAHCRVAQNGGFFRMNSGECLGNVVSDARRVSSSGGLQNAQFGIRRDGTLVT
GYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISAR
TAIGHDRKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLA
SYPSDHCQDNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWQGPGCDEL
DCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPDCQRPCKCEHHCPCDPKTGN
CSISGVKQCLQPSEATLRAGELSFFTRTAWLALTLALAFLLLISTAANLSLLLSRAERNR
RLHGDYAYHPLQEMNGEPLATEKEQPGGAHNPFKD
Download sequence
Identical sequences G1RG36
ENSNLEP00000012186 ENSNLEP00000012186 XP_003269290.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]