SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012337 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012337
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000249
Family LysM domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012337   Gene: ENSNLEG00000010117   Transcript: ENSNLET00000012937
Sequence length 226
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:1888141:1895878:-1 gene:ENSNLEG00000010117 transcript:ENSNLET00000012937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEEVHPSNDEVWPHS
TERKKQETGAGRANEVLPTPGQETPTPTHDLSASDFLKKLDSQISLSKKAAAQKLKKGEN
GVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences A0A2I3GCX4
ENSNLEP00000012337 ENSNLEP00000012337 XP_003259265.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]