SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012396 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012396
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily POZ domain 8.63e-31
Family BTB/POZ domain 0.00046
Further Details:      
 
Domain Number 2 Region: 416-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000747
Family Classic zinc finger, C2H2 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012396   Gene: ENSNLEG00000010171   Transcript: ENSNLET00000012999
Sequence length 479
Comment pep:known_by_projection supercontig:Nleu1.0:GL397482.1:1152062:1191622:-1 gene:ENSNLEG00000010171 transcript:ENSNLET00000012999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNRKEDMEIASHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLY
CQVQKTSEQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQA
CHDFIKAALDISIKSDASDELAEFEIGAASSSSTEALISAVMAGRSISPWLARRTSPANS
SGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGG
SELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNRKNKETVRHITQQVEDDSRAGSPVPSFL
PTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDA
LHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKC
PYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVSAGRVRVPRTVC
Download sequence
Identical sequences ENSNLEP00000012396 ENSNLEP00000012396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]