SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012418 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012418
Domain Number 1 Region: 42-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000221
Family EGF-type module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012418   Gene: ENSNLEG00000010189   Transcript: ENSNLET00000013024
Sequence length 160
Comment pep:known_by_projection supercontig:Nleu1.0:GL397287.1:24137570:24245325:-1 gene:ENSNLEG00000010189 transcript:ENSNLET00000013024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Download sequence
Identical sequences A0A2J8N499 P01135
ENSNLEP00000012418 gi|4507461|ref|NP_003227.1| ENSP00000295400 ENSP00000475235 ENSNLEP00000012418 NP_003227.1.87134 NP_003227.1.92137 XP_001142892.1.37143 XP_003262568.1.23891 XP_018877140.1.27298 ENSP00000295400 9606.ENSP00000295400 ENSPTRP00000020654 ENSPTRP00000020654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]