SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012509 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012509
Domain Number 1 Region: 44-175
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.11e-36
Family Methylmalonyl-CoA epimerase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012509   Gene: ENSNLEG00000010264   Transcript: ENSNLET00000013120
Sequence length 176
Comment pep:known_by_projection supercontig:Nleu1.0:GL397287.1:24750545:24770673:-1 gene:ENSNLEG00000010264 transcript:ENSNLET00000013120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARALKTAAANAVGLFSRLRAPIPTVRASSTSQPLDQVAGSVWNLGRLNHVAIAVPDLEK
AAAFYKNILGAQVSEVVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGM
HHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA
Download sequence
Identical sequences G1RH09
XP_003262580.1.23891 ENSNLEP00000012509 ENSNLEP00000012509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]