SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012621 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012621
Domain Number 1 Region: 207-396
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-41
Family Laminin G-like module 0.00000000497
Further Details:      
 
Domain Number 2 Region: 412-619
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.41e-34
Family Laminin G-like module 0.00000000587
Further Details:      
 
Domain Number 3 Region: 96-229
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000118
Family Growth factor receptor domain 0.025
Further Details:      
 
Domain Number 4 Region: 64-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000016
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012621   Gene: ENSNLEG00000010348   Transcript: ENSNLET00000013242
Sequence length 624
Comment pep:known_by_projection supercontig:Nleu1.0:GL397832.1:51332:80001:1 gene:ENSNLEG00000010348 transcript:ENSNLET00000013242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCICQASPPPAALARCLLSSCVQPAREHGGAFSKAEWLSNCINKYGSPYTKNSGFATCVQ
NLPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQICHNK
LGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEK
ACQDVDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKS
LYLGRMFSGTPVIRLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGR
LELQLRYNGVGRVTSSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPER
GLYHLNLTVGGIPFHEKDLVQPINPRLDGCMRSWNWLNGEDTTIHEAVKVNARMQCFSVT
ERGSFYPGSGFAFYSLDYVRTPLDVGTESTWEIDVVAHIRPAADTGVLFALWVPDLRAVP
LSVALVDYHSTKKLKKQLVVLAVEHVALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTR
GQSEVSATQLQERLARAREALRSPVLTFAGGCPDVPVTSAPVTAFYRGCMTLEVNRRLLD
LDEAAYKHSDITAHSCPPVEPAAA
Download sequence
Identical sequences ENSNLEP00000012621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]