SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012782 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012782
Domain Number 1 Region: 190-359,400-468,550-587,691-725
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.69e-28
Family Quinoprotein alcohol dehydrogenase-like 0.042
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000012782
Domain Number - Region: 89-227
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00373
Family SGL-like 0.034
Further Details:      
 
Domain Number - Region: 1197-1349
Classification Level Classification E-value
Superfamily ARM repeat 0.0263
Family PBS lyase HEAT-like repeat 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012782   Gene: ENSNLEG00000010497   Transcript: ENSNLET00000013409
Sequence length 1615
Comment pep:known_by_projection supercontig:Nleu1.0:GL397529.1:80953:89876:1 gene:ENSNLEG00000010497 transcript:ENSNLET00000013409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEAWEARGNLVLDSDLYDADGYDVPDPGLLTEKNELTFTEPSQVLPFLTSSQQWQSLT
PRARARQLWLLLRTSLQEVVEKEKRAELRVARLTHGLEPLRRLEVAAGLRSVAQDPVGGR
FVVLDGAGRLHLHKEDWAQETLLAPVGLTGLVTVLGPLGAVGRFVGWGPAGLAIGPTSLL
WLSEQGVGRAPGWAPTCCLPVPDLRLLLVAEMDSSLALWQFRSGGRRLVLRGSPLHPPPS
PTGRLMRLAVAPVPPHHVLRCFAAYGSAVLTFDLHAWTLLDVRRDLHKTTISDLAYCEEV
EAMVTASRDSTVKVWEADWQIRMVFVGHTGPVTAMAVLPNTNLVVSASQDGTLRTWDLQA
AAQVGEVALGFWGQDKLSRRVGRLLAPVRPGWPVLSLCASSMQLWRVRELYSPLAQLPAK
VLHVQVAPALPVPAHQSLPMRLVCACADGSVYLLSAATGRIVSSLLLEPEDCAAAVAYCL
PREALWLLTRAGHLVRANAARCPMSVLHRVCPPPPPAPQPCCLHLYSHLTDLGGAFSSWE
VVRQHWGELRCSAVACAWKNKNRYLPVVGHTDGTLSVLEWLSSKTVFQTEAHSPGPVVAC
RHRIHWNSMVPTGGDLTVKMRVFPYAEESLSLLRTFSCCYPAVVLCALGRRVTVGFEDPD
SAYGLVQFGLGDSPRLDHRPQDDPTDHITGLCCCPALKLYACSSLDCTIRIWTAENRLLR
LLQLNGAPQALAFCSNSGDLVLALGSRLCLVSHRLYLPTSYLVEKMCQKAPDVVDDPPLP
LMSQESLTSAQLQRLTNLHGAAGLSKALSLIHRRRATSQHLVPKEDLDALVARDRDLQQL
RLGLVVPAARPPPSWQQRQEGFDNYLRLIYGSGLLGMQSGRESQQWSARTLTVERETQDV
CALPQAAHRLARAEVSTAAQTVPTALSPWDLGALGQHFSQPPRVTVPIPPTHRRVHSKAS
QLLARSSLSHYLGISLDLQLRGRTTMALDLPSSHLQCRIPLLPKRRSKEPLSSLRGFFPA
TVQPHKHCLRPICFPGYVPNSVVLQQMWLNAEPGASQDALWLWRPRPSQAQWQRKLLQWM
GEKPGEEAEEDQKKEEEEEEDEKLDRASASLSPHSNQQLDSWELEDQSAVDWTQEPRQHT
CEAARTHPHPWHRHGSLLLDEHYGHLPKFLHFFIHQTWFKKLFPIFSLQVYPEAGTMEGL
ASLLVALLEETMWVDRVHILRVLLRLLPNMSSDLQGQLQGLLVHLLNLDQPPRLQDQTQK
KFVMLALQLLLACSLESRDVVLELMSYFLYSPVHCRPELKKLLHRLGLQDPEGFLFKEMM
TWVQGPDLESKAGLRTRCCQKLEDMIQQLQETQSQTSVVSGAPTRASVIPSGTSRSPSSI
FGRLSRVSEVPVMVVSSAELHSLAPELQPQRTLAPTRSWGTRQLRLGVLSETLKNFCPEA
EARLHPAGPAQLPGEPPPLEETDWSHSQLLDLGPIDALNFFCEQLRARQRSSLQEEAAHP
HPHPPVPDTVAPVPNMVVPPPREHWYHPIFRLQEAKAQWSARSAKRLRGPMPSRLCAGRT
LDGPIRTLKLPLPRVEPQPFPLDWPTPPRPLPPRLLQPALQRYFLPEDADPDTYS
Download sequence
Identical sequences ENSNLEP00000012782 ENSNLEP00000012782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]