SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012849 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012849
Domain Number 1 Region: 131-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.55e-54
Family C-terminal domain of adrenodoxin reductase-like 0.00000000562
Further Details:      
 
Domain Number 2 Region: 29-190
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.82e-20
Family N-terminal domain of adrenodoxin reductase-like 0.00000597
Further Details:      
 
Domain Number 3 Region: 329-482
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000577
Family N-terminal domain of adrenodoxin reductase-like 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012849   Gene: ENSNLEG00000010483   Transcript: ENSNLET00000013481
Sequence length 483
Comment pep:known_by_projection supercontig:Nleu1.0:GL397612.1:226968:238826:-1 gene:ENSNLEG00000010483 transcript:ENSNLET00000013481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCKCQSLEEQEKEDAGFCHHFSTKEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIY
EKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHA
VVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVA
LDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLP
GARPILDPADFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPEEAARQASASRAWGLRFF
RSPQQVLPSPDGRRAAGVRLAVTRLEGVHEATRAVPTGDMEDLPCGLVLSSIGYKSRPVD
PSVPFDSKLGVIPNVEGRVLDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAG
LLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRL
LGH
Download sequence
Identical sequences ENSNLEP00000012849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]