SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012872 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012872
Domain Number 1 Region: 248-551
Classification Level Classification E-value
Superfamily ALDH-like 5.11e-101
Family ALDH-like 0.00000000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012872   Gene: ENSNLEG00000010561   Transcript: ENSNLET00000013505
Sequence length 562
Comment pep:known_by_projection supercontig:Nleu1.0:GL397287.1:27263706:27268759:1 gene:ENSNLEG00000010561 transcript:ENSNLET00000013505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLWRRRPRLSRMSSTSTRSHWAWSSSSAPGTTPSTSPSSLWWAPSLQVHGPVGREAGGAP
SPSAEPSQDGLRPVLRVLGSDKGLLGLSQEAVGTKLFSQASRCLRSSQAQVSTPNDRERA
CLPLPLLGGWSFCHLICIRASFLEWASAVLPTRPPEPLSPFCFSSNISATQRARWCSSGQ
RVSVRVPLSCARACSWVCPMTCACLLTTLPSTFPRTHDGGEASGVVLGRAKPLVRYPGHR
PGSVCSPGNAVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKERFDHI
LYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNSGQTC
VAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSWDYGRIISARHFQRVMGLIEGQKVA
YGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREKPLAL
YVFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSH
RRSCLVRPLMDEALKVRYPPSP
Download sequence
Identical sequences ENSNLEP00000012872 ENSNLEP00000012872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]