SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000012994 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000012994
Domain Number 1 Region: 117-219
Classification Level Classification E-value
Superfamily POZ domain 3.34e-18
Family Tetramerization domain of potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000012994   Gene: ENSNLEG00000010668   Transcript: ENSNLET00000013631
Sequence length 419
Comment pep:known_by_projection supercontig:Nleu1.0:GL397405.1:83469:128748:1 gene:ENSNLEG00000010668 transcript:ENSNLET00000013631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVHRGSDSDRLLRQEASCLVDDTSAAAQEKEANSLASSGPHNLTYPLGPRNEDLSLDYA
SQPANLQFPHIMPLGEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVT
LLVDGTRFVVNPQIFTAHPDTMLGRMFGPGREYNFTRPNEKGEYEIAEGISATVFRTVLD
YYKTGIINCPDGISIPDLRDTCDYLCINFDFNTIRCQDLSALLHELSNDGAHKQFDHYLE
ELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMGEEYSQILYSSKLYRFFKYIE
NRDVAKTVLKERGLKNIRIGIEGYPTCKEKIKRRPGGRSEVIYNYVQRPFIQMSWEKEEG
KSRHVDFQCVRSKSLTNLVAAGDDVLEDQEILMHHPPQVDELDRLNAPLSQMASNDFQD
Download sequence
Identical sequences M3ZB06
XP_003276944.1.23891 XP_012351958.1.23891 ENSNLEP00000012994 ENSNLEP00000023893 ENSNLEP00000012994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]