SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013023 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013023
Domain Number 1 Region: 49-462
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 5.23e-99
Family Iron-containing alcohol dehydrogenase 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013023   Gene: ENSNLEG00000010666   Transcript: ENSNLET00000013660
Sequence length 467
Comment pep:known_by_projection supercontig:Nleu1.0:GL397367.1:641991:678809:1 gene:ENSNLEG00000010666 transcript:ENSNLET00000013660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAGV
TKEVGMDLQNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDASFM
EAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKP
LIAVPTTSGTGSETTGVAIFDYEPLKVKIGITSRAIKPTLGLIDPLHTLHMPAQVVANSG
FDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRN
PDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKDYNVDHPLVPHGLS
VVLTSPAVFTFTAQMFPERHLETAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGL
AAVGYSKADIPALVKGTLPQERVTKLAPRPQSEEDLAALFEASMKLY
Download sequence
Identical sequences G1RIG7
ENSNLEP00000013023 ENSNLEP00000013023 XP_003274823.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]