SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013157 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013157
Domain Number 1 Region: 247-510
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-59
Family Kelch motif 0.000099
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily POZ domain 0.0000212
Family BTB/POZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013157   Gene: ENSNLEG00000010821   Transcript: ENSNLET00000013801
Sequence length 532
Comment pep:known_by_projection supercontig:Nleu1.0:GL397514.1:923861:925724:-1 gene:ENSNLEG00000010821 transcript:ENSNLET00000013801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSGMRESQGTEVSLRTISTQDLRLLVSFAYSGVVRARWPGLLRAAQAALQYQSSSCLD
LCQKGLARGLSPARCLALFPMAEAPGLERLWSKARHYLLTHLPAVALCPAFPSLPAACLA
ELLGSDELHVQEEFEAFVAARCWLAANPETQESEAKALLRCVRFGRMSTRELRRVRAAGL
LPPLTPDLLHQLMVEADVPGQERRREPDRALVVIGGDGLRPDMALRQPSQAVWWARAFRC
GVGLVRTVEWGQLPALPAPGRFRHGAASLAGSELYVCGGQDFYSHSNTLASTLRWEPSQE
DWEEMAPLSQARSLFPLVALDGKLYALGGRHNGVAMDAETYNPELDVWRPAHAFPAPSFA
HAGAILEGQLYVSGGCGGIGQYLASLMHYDPKLEKPGTFLSPMGVPRAGHVMAALGGRLY
VAGGLGETGDLLSFEAYELRTDSWTHLAPLPSPHVGAASAVLQGELLVLGGYSHRTYALS
HLIHAYCPGLGRWLCLGTLPRPRAEMPACILTLPTVQHIALVPTPHQTKPAG
Download sequence
Identical sequences ENSNLEP00000013157 ENSNLEP00000013157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]