SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013400 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013400
Domain Number 1 Region: 46-185
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 8.11e-47
Family Molybdopterin synthase subunit MoaE 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013400   Gene: ENSNLEG00000010998   Transcript: ENSNLET00000014063
Sequence length 188
Comment pep:known_by_projection supercontig:Nleu1.0:GL397396.1:2805215:2816095:-1 gene:ENSNLEG00000010998 transcript:ENSNLET00000014063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSCFNLETKLPLSPPLAEDSAFEPSRKDTDEVEEKSKDVINFTAEKLSVDEVS
QLVMSPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSSWKGNK
ECFWASSN
Download sequence
Identical sequences G1RJJ3
XP_003276567.1.23891 XP_003276568.2.23891 ENSNLEP00000013400 ENSNLEP00000013400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]