SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013473 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013473
Domain Number 1 Region: 72-198
Classification Level Classification E-value
Superfamily FKBP-like 1.14e-39
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 
Domain Number 2 Region: 179-295
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-36
Family FKBP immunophilin/proline isomerase 0.00033
Further Details:      
 
Domain Number 3 Region: 303-406
Classification Level Classification E-value
Superfamily FKBP-like 5.3e-31
Family FKBP immunophilin/proline isomerase 0.00051
Further Details:      
 
Domain Number 4 Region: 3-74
Classification Level Classification E-value
Superfamily FKBP-like 9.62e-23
Family FKBP immunophilin/proline isomerase 0.00081
Further Details:      
 
Domain Number 5 Region: 414-487
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000218
Family Calmodulin-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013473   Gene: ENSNLEG00000011092   Transcript: ENSNLET00000014142
Sequence length 501
Comment pep:known_by_projection supercontig:Nleu1.0:GL397460.1:712099:717929:1 gene:ENSNLEG00000011092 transcript:ENSNLET00000014142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATLY
FDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGTLLDGTSFDTSYSRGGTY
DTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGEKGYGTVIPPQASLVFHVLLIDV
HNPKDTVQLETLELPAGCVRRAGAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYIGQGY
IIPGMDQGLQGACMGERRRITIPPHLAYGENGTGDKIPGSAVLIFNVHVIDFHNPADVVE
IRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDT
GLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLPTGYLFVWHEDP
PANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGK
ITVEELKLKSDEDQELVHEEL
Download sequence
Identical sequences ENSNLEP00000013473 ENSNLEP00000013473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]