SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013679 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000013679
Domain Number - Region: 13-72
Classification Level Classification E-value
Superfamily ISY1 domain-like 0.00562
Family ISY1 N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013679   Gene: ENSNLEG00000011254   Transcript: ENSNLET00000014357
Sequence length 97
Comment pep:known_by_projection supercontig:Nleu1.0:GL397405.1:1116534:1134478:-1 gene:ENSNLEG00000011254 transcript:ENSNLET00000014357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKKRENLGVALEIDELEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKA
SNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM
Download sequence
Identical sequences G1RKC2
XP_003276962.1.23891 ENSNLEP00000013679 ENSNLEP00000013679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]