SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013754 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013754
Domain Number 1 Region: 294-425
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-37
Family Mannose 6-phosphate receptor domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 144-285
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.01e-36
Family Mannose 6-phosphate receptor domain 0.00056
Further Details:      
 
Domain Number 3 Region: 2-141
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-31
Family Mannose 6-phosphate receptor domain 0.00016
Further Details:      
 
Domain Number 4 Region: 430-575
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 5 Region: 911-1058
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.37e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 6 Region: 782-909
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.84e-29
Family Mannose 6-phosphate receptor domain 0.00084
Further Details:      
 
Domain Number 7 Region: 582-675,724-767
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-21
Family Mannose 6-phosphate receptor domain 0.0032
Further Details:      
 
Domain Number 8 Region: 674-723
Classification Level Classification E-value
Superfamily Kringle-like 1.34e-16
Family Fibronectin type II module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013754   Gene: ENSNLEG00000011313   Transcript: ENSNLET00000014432
Sequence length 1270
Comment pep:known_by_projection supercontig:Nleu1.0:GL397340.1:2839341:2879358:1 gene:ENSNLEG00000011313 transcript:ENSNLET00000014432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEGDNCEVKDPRHGNLYDLKPLGLNDTIVNAGEYTYYFRVCGKLSSDICPTNDKSKVVSS
CQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCHKVYQRSTAIFFYCDHSTQQPV
FLKETSDCSYLFEWRTQYACPPFDLTECSFKDGAGNSFDLSSLSRYSDNWEAITGTGDPE
HYLINVCKSLAPQAGTEPCPPEAAACLLGGSKPVNLGRVRDGPQWRDGIIVLKYVDGDLC
PDGIRKKSTTIRFTCSESQVNSRPMFISAVEDCEYTFAWPTATACPMKSNEHDDCQVTNP
STGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRL
RYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWH
TPLACEQATECSVRNGSSIVDLSPLIHRTGGYEAYDESEDDASDTNPDFYINICQPLNPM
HGVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPVANEIYLNFESSTPCLADKHFNYTSL
IAFHCKRGVSMGTPKLLRTSECDFVFEWETPIVCPDEVRMEGCTLTDEQLLYSFNLSSLS
TSTFKVTRDSRTYSIGVCTVAAGPEQGGCKDGGVCLLSGTKGASFGRLQSMKLDYRHQDE
AVILSYVNGDRCPPETDEGVPCVFPFIFNGKSYEECIIESRAKLWCSTTADYDRDHEWGF
CRHSNSYRTSSIIFKCDEDEDIGRPQVFSEVRGCDVTFEWKTKVVCPPKKMECKFIQKHK
TYDLRLLSSLTGHWSLVHDGVSYYINLCQKIYKGPLGCSERASICRRTTTGDVQVLGLVH
TQKLGVIGDKVVVTYSKGYPCGGNKTASSVIELTCTKTVGRPAFKRFDIDSCTYYFSWDS
RAACAVKPQEVQMVNGTITNPINGKSFSLGDIYFKLFRASGDMRTNGDNYLYEIQLSSIT
SSRNPACSGANICQVKPNDQHFSRKVGTSDKTKYYLQDGDLDVVFASSSKCGKDKTKSVS
STIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAVCPLGVGFDSENPGDDGQMHKGLSE
RSQAVGAVLSLLLVALTCCLLALLLYKKERRETVISKLTTCCRRSSNVSYXXXXVNKEEE
TDENETEWLMEEIQLPPPRQGKEGQENGHITTKSVKALSSLHGDDQDSEDEVLTIPEVKV
HSGRGAGAESSHPVRNAQSNALQEREDDRAGLVRGEKARKGKSSSAQQKTVSSTKLVSFH
DDSDEDLLHI
Download sequence
Identical sequences ENSNLEP00000013754 ENSNLEP00000013754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]