SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013813 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013813
Domain Number 1 Region: 17-180
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 5.64e-36
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013813   Gene: ENSNLEG00000011328   Transcript: ENSNLET00000014492
Sequence length 184
Comment pep:known_by_projection supercontig:Nleu1.0:GL397405.1:2317115:2339866:-1 gene:ENSNLEG00000011328 transcript:ENSNLET00000014492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPAMKFSLYFLAYEDKNDIPKDKDEKIAWALSRKATLELTHNCGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
Download sequence
Identical sequences A0A2I3HKG7
ENSNLEP00000013813 XP_003276968.1.23891 ENSNLEP00000013813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]