SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013972 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013972
Domain Number 1 Region: 229-387
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.56e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000054
Further Details:      
 
Domain Number 2 Region: 68-226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.2e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000673
Further Details:      
 
Domain Number 3 Region: 25-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family EGF-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013972   Gene: ENSNLEG00000011483   Transcript: ENSNLET00000014657
Sequence length 387
Comment pep:known_by_projection supercontig:Nleu1.0:GL397317.1:6246570:6261050:-1 gene:ENSNLEG00000011483 transcript:ENSNLET00000014657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPCLLAALCGALLCAPGLLVALDICSRNPCHNGGLCEEISQEVRGDVFPSYTCTCLKG
YAGNHCEMKCVEPLGMENGNIANSQITASSVRVTFLSLQHWAPELARLNRAGMVNAWTPS
SNDENPWIQVNLLRRMWVTGVVTQGASRLASPEYLKAFKVAYSLNGHEFDFIHDVNKKHK
EFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCTNPLGLKNNS
IPDKQITASSSYKTWGLHLFSWNPSYARXXXXXXXXXXXXGSYSNDQWLQVDLGSPKEVT
GIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFET
PILARYVRILPVAWHNRIALRLELLGC
Download sequence
Identical sequences ENSNLEP00000013972 ENSNLEP00000013972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]