SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014215 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014215
Domain Number 1 Region: 87-234,480-593,642-745
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.49e-51
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 2 Region: 181-237,282-517
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.17e-19
Family WD40-repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014215   Gene: ENSNLEG00000011671   Transcript: ENSNLET00000014910
Sequence length 1501
Comment pep:known_by_projection supercontig:Nleu1.0:GL397480.1:1488615:1544007:1 gene:ENSNLEG00000011671 transcript:ENSNLET00000014910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVGSGGYARNDAGEKLPSVMAGVPARRGQSSPPPAPPLCLRRRTRLSTASEETVQNRV
SLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVILDPKENKQQHIFNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDAEEKNQVAEMLGHKYGVACVAFSPNMKYIVSMGYQHDMV
LNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTETKVTSTVPL
VGRSGILGELHNNIFCGVACGRGRMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRVFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHRKAEAVYP
DTVALTFDPIHQWLSCMYKDHSIYIWDVKDINRVGKVWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNLDSSPDSHWQKNIFSNTLLKVVYVENDIRHLQDMSHFPD
RGSENGTPMDVKAGVRVMQVSPDGQHLASGDRSGNLRQHCLHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGNRDIQMISCG
ADKSIYFRSAQQGSDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNG
KQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGHSEIITS
MKFTYDCHHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDHQQQQHTKDKKRSGHPRQDT
YVSTPSEIRSLSPGEQTEDDLEEECEPEEMLKTPSKDSLDPDPRCLLTNGKLPLWAKRLL
GDDDVADGSAFHAKRSYQPHGRWAERASQEPLKTILDAQDLDCYFTPMKPESLENSILDS
LEPQSLASLLSESGSPQEAGRGHPSFLPQQKESSEASELILYSLEAEVTVTGTDSQYCGK
EVEAGPGDQQGDSYVRVSSDSPKDQSPPEDSGESEADLECSFAAIHSPSPPPDPAPWFAT
SLPHFPGCTGPTEDELSLPEGPSVPSSSLPQTPEQEKFLRHHFETLTESPCRELFPAALG
DVEASEAEDYFFNPRLSISTQFFSSLQKASRFTHTFSPRATQRLVKSPEVRLMDRGGSQP
RAGTGYASPDGTHVSIGATSSALRLHGSAFHPSLPAPESPGLPAHPSNPQLPEAGPGIPG
STPPSWSPPLVSTALEQGLSPKLILCASWLSSKDGYLTWPQGLPWHMGHGGKQHRELTAS
MGAMPRLNLRNPSYVSRSDMLRRDRRARECRVGTGVGITNQKMRRGFREEAVLEQRPVGV
EGALGTQRSVPDRRTAWSPPSCPGRSHQWNAARLAHSLLSTPGALSLFQGSPARWSEPWV
PAEALPPSPLELSRVGNILHRLQTTFQEALDLYRVLVSSGQVDTGQQQARTELVSTFLWI
HSQLEAECLVGTSVASAQALPSPGPPSPPMLCPLASPDLQALLEHYSELLVQAVRRKARG
H
Download sequence
Identical sequences ENSNLEP00000014215 ENSNLEP00000014215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]