SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014311 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014311
Domain Number 1 Region: 143-330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.28e-38
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 2 Region: 33-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00067
Further Details:      
 
Domain Number 3 Region: 333-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-32
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 4 Region: 967-1020,1082-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.17e-32
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 5 Region: 777-959
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6e-28
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 6 Region: 571-628
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000124
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 
Domain Number 7 Region: 542-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014311   Gene: ENSNLEG00000011756   Transcript: ENSNLET00000015019
Sequence length 1384
Comment pep:known_by_projection supercontig:Nleu1.0:GL397460.1:1603345:1620527:1 gene:ENSNLEG00000011756 transcript:ENSNLET00000015019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRLRLFCILLAAVSGAEGWGYYGCDEELVGPLYARSLGASSYYSLLTAPRFARLHGISG
WSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHN
STFFGNVNESAVVRHDLHYHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKADILYFDGD
DAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELEGAHLLLHMSLGS
SPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTE
MFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCLDPVP
HPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSRLGDGLGHVELTLSEGQVN
VSIAQSGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTGT
SYFFGGCPKPASRWDCHSNQTAFHGCMELLKVDGQLVNLTLVEGRRLGFYAEVLFDTCGI
TDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHTPLYKESCEAYRLSGKTSGNFTI
DPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAIQYWNASWEEVS
ALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGLD
RSCVDPALYCNCDADQPQWRTDKGLLTFVDHLPVTQVVIGDTNRSTSEAQFFLRPLRCYG
DRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPYCQWRRPYVRV
ELNTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRP
MPLQTYIWMEYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTSPNCTGH
CAHPRLPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSA
AREFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPDYPRPGRPVPGYRGPVYNVT
GEEVSFSFSTSSAPAVLLYVSSFVRDYMAVLIKDDGTLQLRYQLGTSPYVYQLTTRPVTD
GQPHSVNITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQR
YNTPGFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEALRVQGELSESNCGAMPRLVSEV
PPELDPWYLPPDFPYYHDEGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEP
KAAHEYHPGSKPPLPTSGPAQVPTPTPAPNQAPASAPAPAPTPAPAPGPRDQNLPQILEE
SRSE
Download sequence
Identical sequences G1RM47
XP_003279528.1.23891 ENSNLEP00000014311 ENSNLEP00000014311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]