SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014541 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014541
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily EF-hand 2.86e-39
Family Calmodulin-like 0.00000734
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014541   Gene: ENSNLEG00000011976   Transcript: ENSNLET00000015266
Sequence length 148
Comment pep:known_by_projection supercontig:Nleu1.0:GL397355.1:4536044:4538043:-1 gene:ENSNLEG00000011976 transcript:ENSNLET00000015266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLEEFQQLYIKFFPYSDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNW
AFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKD
DQITLEEFKEAAKSDPSIVLLLQCDMQK
Download sequence
Identical sequences ENSNLEP00000014541 ENSNLEP00000014541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]