SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014653 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014653
Domain Number 1 Region: 36-135
Classification Level Classification E-value
Superfamily Immunoglobulin 3.25e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 178-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000034
Family EGF-type module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014653   Gene: ENSNLEG00000012030   Transcript: ENSNLET00000015385
Sequence length 648
Comment pep:known_by_projection supercontig:Nleu1.0:GL397325.1:2847184:3066939:1 gene:ENSNLEG00000012030 transcript:ENSNLET00000015385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNVKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSASANITIVESNEIVTGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKHLGIEF
MEAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNI
ANGPHHPNPPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPS
HSWSNGHTESILSESHSVIMMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETP
DSYRDSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFV
EEERPLLLVTPPKLREKKFDHHPQQFSSFHHNPAHDSNSLPASPLRIVEDEEYETTQEYE
PAQEPVKKLANSRRAKRTKPNGHIANRLEVDSNTSSQSSNSESETEDERVGEDTPFLGIQ
NPLAASLEATPAFRLADSRTNPAGRFSTQEEIQARLSSVIANQDPIAV
Download sequence
Identical sequences ENSNLEP00000014653 ENSNLEP00000014653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]