SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014830 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014830
Domain Number 1 Region: 617-1144
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.3e-154
Family alpha-mannosidase, C-terminal domain 0.00000124
Further Details:      
 
Domain Number 2 Region: 124-494
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.46e-129
Family alpha-mannosidase 0.00000000224
Further Details:      
 
Domain Number 3 Region: 497-611
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 8.5e-29
Family alpha-mannosidase, domain 2 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014830   Gene: ENSNLEG00000012209   Transcript: ENSNLET00000015575
Sequence length 1145
Comment pep:known_by_projection supercontig:Nleu1.0:GL397317.1:8257473:8273351:1 gene:ENSNLEG00000012209 transcript:ENSNLET00000015575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANAEGPPAMLPYYTVNGSWVVPPEPRPSFFSISPQDCQFAL
GGRGQKPELQMLTVSEELPFDNVDGGVWRQGFLSVWDSEDLQVFLVTQSSMTQGWIKTFD
KYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINAQKRAAVRRLVGNGQLEI
ATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYLLRRAN
LTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPDPK
ICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSRLFRSNVLLVPLGD
DFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPGARPPG
FPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLA
GRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHY
LVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFSMVS
LLVNSPRLRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVPVRLPALGLGVLQLQLGLD
GHRTLPSSVRVYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIR
RVDEEQEQQVDMQVFVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPFFSEVV
AYYEHIHQAVRLYNLPGVEGLSLDISSLVDIRDYVNKELALRIHTDIDSQGIFFTDLNGF
QVQPRRYLKKLPLQANFYPMPVMAYIQDAQKRLTLHTAQALGVSSLKDGQLEVILDRRLM
QDDNRGLGQGLKDNKRTCNRFRLLLERRTVGSEVQDSHSTSYPSLLSHLTSTYLNTPVLA
LPVARTQLPGPGLRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRKGFDCGL
EAKNLGFNCTTSQGKVALGSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYLEPMEIATF
RLRLG
Download sequence
Identical sequences ENSNLEP00000014830 ENSNLEP00000014830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]