SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014900 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014900
Domain Number 1 Region: 31-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.58e-92
Family Carbonic anhydrase 0.0000000000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014900   Gene: ENSNLEG00000012252   Transcript: ENSNLET00000015645
Sequence length 354
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:6867424:6927059:-1 gene:ENSNLEG00000012252 transcript:ENSNLET00000015645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRSLHAAAVILLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTISGQHFAAELHIVHYNSDLYPDASIASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFIPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGVLGICIVVAVSIWLFRRKSVKKGDDKGVIYKPATKMETEAHA
Download sequence
Identical sequences G1RNT6
XP_003267130.1.23891 ENSNLEP00000014900 ENSNLEP00000014900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]