SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014919 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014919
Domain Number 1 Region: 258-436
Classification Level Classification E-value
Superfamily ITPase-like 1.74e-30
Family YjjX-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014919   Gene: ENSNLEG00000012281   Transcript: ENSNLET00000015664
Sequence length 444
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:26736436:26771419:1 gene:ENSNLEG00000012281 transcript:ENSNLET00000015664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPNPAGLAATALSSTTVPLATSSFSSPNVSSMESFPPLAYSTPQP
PLPPVRPSVPLPFVPPPAVPSVPPLVTSMPPPISPSTAAAFGNPPVSHFPPSTSAPNTLL
PAPPSGPPISGFSVGSTYDITRGHAGRAPQTPLMPSFSAPSGTGLLPTPITQQASLTSLA
QGTGTTSAITFPEEQEDPRIDRGQDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVESMI
TTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPVG
YAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHGIHLE
TFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEFLEKSLLNVSRTDWHMAFTGMSR
RQMIYSAARAIAGMYKQRLPPRTL
Download sequence
Identical sequences ENSNLEP00000014919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]