SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015039 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015039
Domain Number 1 Region: 2293-2365
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.92e-19
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 2 Region: 909-978
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.32e-19
Family TB module/8-cys domain 0.00065
Further Details:      
 
Domain Number 3 Region: 1644-1715
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.24e-18
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 4 Region: 2008-2079
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.31e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 5 Region: 270-336
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-18
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 6 Region: 493-614
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-18
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 7 Region: 2086-2220
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 1805-1931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 9 Region: 671-813
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 10 Region: 124-209
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.27e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 11 Region: 2408-2536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 804-888
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.41e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 13 Region: 985-1119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.91e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 14 Region: 1275-1410
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000126
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 15 Region: 1484-1557
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000183
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 16 Region: 609-681
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000235
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 17 Region: 1151-1293
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000243
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 18 Region: 2533-2649
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 166-282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000392
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 20 Region: 1563-1618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000179
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 21 Region: 2368-2413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000336
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 22 Region: 2179-2295
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000124
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 23 Region: 1969-2022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 24 Region: 1115-1163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000227
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 25 Region: 408-501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 26 Region: 1441-1488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000014
Family EGF-type module 0.00059
Further Details:      
 
Domain Number 27 Region: 1722-1776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000486
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 28 Region: 1399-1448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000617
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 29 Region: 1924-1966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000288
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 30 Region: 1765-1803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000011
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015039
Domain Number - Region: 95-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00281
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2742-2788
Classification Level Classification E-value
Superfamily Cadherin-like 0.00476
Family Cadherin 0.013
Further Details:      
 
Domain Number - Region: 61-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015039   Gene: ENSNLEG00000012338   Transcript: ENSNLET00000015790
Sequence length 2827
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:27502374:27788749:-1 gene:ENSNLEG00000012338 transcript:ENSNLET00000015790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQISPTCGSKS
IQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGP
QCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGF
IPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECRCPAGHKQSETTQKCEDIDECSII
PGICETGECSNTVGSYFCVCPRGYVTSTDGSRCIDQRTGMCFSGLVNGRCAQELPGRMTK
MQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTAGNGFAPS
GNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLC
LNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQ
RTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTN
MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDCP
PGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCP
AKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASG
RNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCVNGA
CRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDSRCEVNINGATLKSECCATLG
AAWGSPCERCELDTACPRGLARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEG
LTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKPGT
KEYETLCPRGAGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFA
LDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERN
PLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSGNLCRNGKCVNMIGTYQC
SCNPGYQAMPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYALMPDGRSCADID
ECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMRTCIDVNECDLNSNICMFGECENTK
GSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNIPGSFKCSCREGWIGNGIK
CIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQC
LNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDR
TGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGP
RGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPIT
IILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGP
GTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCT
YNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCI
NQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAVGFKLS
PNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGN
GTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNGRCFNEIGSFKCLCNEGY
ELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSENCIDINECDEDPN
ICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAK
CCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNG
QCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECNCNEGFEP
GPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDC
ESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRSKPGICENGRCVNIIGSYRCEC
NEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKSECCCDGGRGWGHQCELC
PLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNGQCINTMGSFRCFCQVGYTTDIS
GTSCIDLDECSQSPKPCNFICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQF
LCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSL
DATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNACG
SASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYGCSNTEGGYLCGCPPGY
YRVGQGHCVSGMGFNKGQYLSLDTEVDEENALSPEACYECKINGYSKKDSRQKRSIHEPD
PTAVEQISLESVDMDSPVNMKFNLSHLGSNEHILELRPAIQPLNNHIRYVISQGNDDSVF
RIHQRNGLSYLHTAKKKLMPGTYTLEITSVPLYKKKELKKLEESNEDDYLLGELGEALRM
RLQIQLY
Download sequence
Identical sequences ENSNLEP00000015039 ENSNLEP00000015039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]