SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015080 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015080
Domain Number 1 Region: 5-56
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000373
Family LEM domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015080   Gene: ENSNLEG00000012425   Transcript: ENSNLET00000015835
Sequence length 353
Comment pep:known_by_projection supercontig:Nleu1.0:GL397577.1:5088:11445:-1 gene:ENSNLEG00000012425 transcript:ENSNLET00000015835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEMTMDAVLARLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEQGGRLPSF
DHHEAGVTALSQDPQRILKPAEGNPTDQAGFPEDRDFGYSVGLNPPEEEAVTSKTCSVPP
SATDTYRAGVTASREPPLYYGVCPVYEDVPARNESHSVAQARMGALAAIALHAGAGGHRP
FLSSLTCASQLARKPLWKAPYPSSEGAWVTSDVKRIVLKFCPLLTDGLCLSESETVNKER
ANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHV
AAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRICYVVDLYLNTPDKM
Download sequence
Identical sequences ENSNLEP00000015080 ENSNLEP00000015080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]