SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015211 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015211
Domain Number 1 Region: 963-1073
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 1421-1537
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-36
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 3 Region: 2719-2830
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-36
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 620-732
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-35
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 5 Region: 3185-3310
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-35
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 2258-2365
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-34
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 7 Region: 1651-1764
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-34
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 8 Region: 1769-1879
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-33
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 9 Region: 3067-3179
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-33
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 10 Region: 1200-1308
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-33
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 11 Region: 3432-3537
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-32
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 12 Region: 1084-1189
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-31
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 13 Region: 2482-2595
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-31
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 14 Region: 1540-1648
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-30
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 15 Region: 2366-2478
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-30
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 16 Region: 3541-3652
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-30
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 17 Region: 1888-1995
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-29
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 18 Region: 2021-2120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-29
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 19 Region: 1309-1418
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-28
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 20 Region: 2122-2243
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-27
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 21 Region: 855-958
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-27
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 22 Region: 2601-2717
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 23 Region: 739-845
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-26
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 24 Region: 500-616
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-24
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 25 Region: 2951-3065
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-24
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 26 Region: 2835-2948
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-22
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 27 Region: 3318-3426
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-19
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 28 Region: 164-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000495
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 29 Region: 463-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000365
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 30 Region: 423-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000359
Family EGF-type module 0.019
Further Details:      
 
Domain Number 31 Region: 214-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000274
Family EGF-type module 0.013
Further Details:      
 
Domain Number 32 Region: 240-378,406-430
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000282
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015211
Domain Number - Region: 381-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00803
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015211   Gene: ENSNLEG00000012456   Transcript: ENSNLET00000015968
Sequence length 3654
Comment pep:known_by_projection supercontig:Nleu1.0:GL397271.1:15532318:15885054:-1 gene:ENSNLEG00000012456 transcript:ENSNLET00000015968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQSTPAWFAVLQNLVLGWRGLTLTCQPGWLVMNMSLPFLWSLATLLTFAEVNGEAGGLE
LQRQKRSINLQPPRMATERGNLVFLTGSAQNIEFRTGSLGKIKLNDEDLSECLHQIQKNK
DDIIELKGSAIGLPQNISSQIYQLNSKLVDLERKFQGLQQTVDKKVCSSNPCQNGGTCLN
LHDSFFCICPPQWKGPLCSADVNECEIYSGTPLSCQNGGTCVNTMGSYSCHCPPETYGPQ
CASKYDDCEGGSVARCVHGICEDSVREQAGEPKYSCICDAGWMSSPNSPACTLDRDECSF
QPGPCSTLVQCFNTQGSFYCGACPTGWQGNGYVCEDINECEINNGGCSVAPPVECVNTPG
SSHCQACPPGYQGDGRVCTLIDICSVSNGGCHPDASCSSTLGSLPLCTCLPGYTGNGYGP
NGCVQLSNTCLSHPCLNGQCIDTVSGYFCKCDSGWTGVNCTENINECLSNPCLHGGTCVD
GINSFSCECTRLWTGALCQLPQQVCGESLSGINGSFSYRSPDVGYVHDVNCFWVIKTEMG
KVLRITFTFFRLESMDNCPHEFLQVYDGDSSSAFQLGRFCGSSLPHELLSSDNALYFHLY
SEHLRNGSGFTVRWETQQPECGGILTGPYGSIKSPGYPGNYPPGRDCVWIVVTSPDLLVT
FTFGTLSLEHHDDCNKDYLEIRDGPLYQDPLLGRFCTTFSVPPLQTTGPFARIHFHSDSQ
ISDQGFHITYLTSPSDLHCGGDYTEPEGELFLPELPGTFTHTRQCVYMIKQPQGEQIQIN
FTHVELQCQSDSPQNYIEVRDGETLLGKVCGNGTVSHIKSITNSVWIRFKIDASVEKASF
RAVYQVACGGELTGEGVIRSPFFPNVYPGERTCRWTIHQPQSQVIFLNFTVFETGSSAHC
ETDYIEIGSSSILGSPENKKYCGTDIPSFITSVYNFLYVTFVKSSSTENHGFMAKFSAED
LACGEILTESTGTIQSPGHPNVYPHGINCTWHILVQPNHLIHLMFKTFHLEFHYNCTNDY
LEVYDTDSETSLGRYCGKSIPPSLTSSGNSLMLVFVTDSDLAYEGFLINYEAISAATACL
QDYTDDLGTLTSPNFPNNYPNNWECIYRITVRTGQLIAVHFTNFSLEEAIGNYYTDFLEI
RDGGYEKSPLLGIFYGSNLPPTIISHSNKLWLKFKSDQIDTRSGFSAYWDGSSTGCGGNL
TTSSGMFISPNYPMPYYHSSECYWWLKSSHGSAFELEFKDFHLEHHPNCTLDYLAVYDGP
SSNSHLLTQLCGDEKPPLIRSSGDSMFIKLRTDEGQQGRGFEAEYRQTCENVVIVNQTYG
ILESIGYPNPYSENQRCNWTIRATTGNTVNYTFLAFDLEHHINCSTDYLELYDGPRWMGR
YCGVDLPPPGSTTSSRLQVLLLTDGVGRHEKGFQMQWFVYGCGGELSGATGSFSSPGYPN
RYPPNKECIWYIRTAPGSSIQLTIHDFDVEYHSRCNFDVLEIYGGPDFHSPRIAQLCTQR
SPENPMQVSSTGNELAIRFKTDLSINGRGFNASWQAVPGGCGGIFQAPGGEIHSPNYPSP
YRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQDSCIMAYDGLSSTMPRLAKTCGREQLANP
IVSSGNNLFLRFQSGLSRQNRGFRAQFRQACGGHILTSLFDTVSSPRFPANYPNNQNCSW
IIQAQPPLNHITLSFTHFELERSTTCAHDFVEILDGGHEDAPLRGRYCGTDIPHPITSFS
SALMLRFISDSSMSAGGFHATVTASVSACGGTFYMAEGIFNSPGYPDVYPPNVECVWNII
SSPGNRLQLSFISFQLEDSQDCSRDFVEIHEGNATGHLVGRYCGNSFPLNYSSIVGHTLW
VRFISDGSGSGTGFQATFMKIFGNDNIVGTHGKVASPFWPENYPHNSNYQWTVNVNVSHV
VHGRILEMDIEETQNCYYDKLRIYDGPSIHTRLIGAYCGTQTESFSSTGNSLTFHFYSDS
SISGKGFLLEWFAVDAPDGVLPTIAPGACGGFLRTADAPMFLFSPGWPDSYSNRVDCTWL
IQAPDSTVELNILSLDIESHRTCAYDSLVIRDGDNNLAQQLAVLCGREIPGPIRSTGEYM
FIRFTSDSSVTRAGFNASFHKSCGGYLHADRGIITSPKYPETYPSNLNCSWHVLVQSGLT
IAVHFEQPFQIPNGDSSCNQGDYLVLRNGPDIYSPPLGRPGGNGHFCGSHASSTLFTSDN
QMFVQFISDHSNEGQGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPDNYPPHADCIW
ILAAPPETRIQLQFEDQFDIEVTPNCTSNYLELRDGVDSDAPILSKFCGTYLPSSQWSSG
EVMYLRFRSDNSPTHVGFKAKYSIAQCGGRVTGQSGVVESIGHPTLPYRDNLFCEWYLQG
LSGHYLTISFEDFNLQNSSGCEKDFVEIWDNHTSGNILGRYCGNTIPDSVDTPSNTAVVR
FVTDGSLTASGFRLRFESSMEECGGDLQGSTGTFTSPNYPNPNARGRICEWRITAPEGRQ
ITLTFNNLRLATHPSCNNEHVIVFNGIRSNSPQLEKLCSSVNVSNEIKSSGNTMKVIFFT
DGSRPYGGFTASYTSSEDAVCGGSLPNTPEGNFTSPGYDGVRNYSRNLNCEWTLSNPNQG
NSSISIHFEDFYLESHQDCQFDVLEFRVGDADGPLMWRLCGPSKPTLPLVIPYSQVWIHF
VTNERVEHIGFHAKYSFTDCGGIQIGESGVITSPNYPNAYDSLTHCSWLLEAPQGHTITL
TFSDFDIEPHTTCAWDSVTVRNGGSPESPIIGQYCGNSNPRTIQSGSNQLVVTFNSDHSL
QGGGFYATWNTQTLGCGGIFHSDNGTIRSPHWPQNFPENSRCSWTVITHKSKHLEISFDN
NFLIPSGDGQCQNSFVKVWAGTEVVDKALLATGCGNVAPGPVVTPSNTFTAVFQSQEAPA
QGFSASFVSRCGSNFTGPSGYIISPNYPKQYDNNMNCTYVIEANPLSVVLLTFVSFHLEA
RSAVTGSCVNDGVHIIRGYSVASTPFATVCGEEMAAPLTIAGPVLLNFYSNEQITDFGFK
FSYRITSCGGVFNFSSGIITSPAYSYTDYPNDMRCLYTITVSDDKVIELKFSDFDVVSST
SCSHDYLAIYDGANTSDPLLGKFCGSKRPPNVKSSNNSMLLVFKTDSFQTAKGWKISFRQ
TLGPQQGCGGYLTGSNNTFASPDSDSNGMYDKNLNCVWIIIAPVNKVIHLTFNTFALEAA
STRQRCLYDYVKLYDGDSENVNLAGTFCGSTVPAPFISSGNFLTVQFISDLTLEREGFNA
TYTIMDMPCGGTYNASWTPQNISSPNSSDPDVPFSICTWVIDAPPHQQVKITVWALELTS
QDCMQNYLQLQDSPQGHGNSRIQFCGRNASAVPVFYSSMSTAIVIFKSGVVNRNSRMSFT
YQIADCNRDYHKAFGKLRSPGWPDNYDNDMDCTVTLTAPQNHTISLFFHSFGIENSVECR
NDFLEVRNGSNSNSPLLGKYCGTLLPNPVFSQNNELYLRFKSDSVTSDHGYEIIWTSSPS
GCGGTLYGDRGSFTSPGYPGTYPNNTHCEWALLAPAGRLVTVNFYFISIDDPGDCVQNYL
TLYDGPNASSPSSGPYCGGDTSIAPFMASSNQVFIKFHADYARHPSAFRLTWDS
Download sequence
Identical sequences ENSNLEP00000015211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]