SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015278 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015278
Domain Number 1 Region: 397-517
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.45e-18
Family Mannose 6-phosphate receptor domain 0.0072
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0048
Further Details:      
 
Domain Number 3 Region: 209-260
Classification Level Classification E-value
Superfamily EF-hand 0.0000491
Family Polcalcin 0.083
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015278
Domain Number - Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 334-421
Classification Level Classification E-value
Superfamily GAT-like domain 0.0487
Family GAT domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015278   Gene: ENSNLEG00000012566   Transcript: ENSNLET00000016051
Sequence length 532
Comment pep:known_by_projection supercontig:Nleu1.0:GL397381.1:2761316:2776188:1 gene:ENSNLEG00000012566 transcript:ENSNLET00000016051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKYVG
DSIWASLQRATANPSSGERPSCPVVGELVSCLLPTQKKLTELQAGKKSLEDQVEMLRTVK
EEAEKPEREAKEQHQKLWEEQLAAAKAQREQELAADAFKELDDDMDGTVSVTELQTHPEL
DTDGDGALSEAEAQDLLSGDTQTDATSFYDRVWAAIRDKYQSEALPTDLAAPSAPDLTEP
KEEQPPVPSPPTEEEEEEEEEEVEEEEEEEDSEVQGEQPKEALPPLSPPQLASPAEEDKM
PPYDEQTQAFIDAAQEARSKFEEAERSLKDMEESLRNLEQEISFDFGPNGEFAYLYSQCY
ELTTNEYIYRLCPFKLVSQKPKLGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGCWQGPN
RSTTVRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
Download sequence
Identical sequences ENSNLEP00000015278 ENSNLEP00000015278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]