SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015381 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000015381
Domain Number - Region: 247-343
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.000561
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015381   Gene: ENSNLEG00000012659   Transcript: ENSNLET00000016167
Sequence length 503
Comment pep:known_by_projection supercontig:Nleu1.0:GL397282.1:19993295:20142908:1 gene:ENSNLEG00000012659 transcript:ENSNLET00000016167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATATHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPV
TTRISDSAVTMDGQAVEVVTLEQ
Download sequence
Identical sequences A0A024R770 A0A096NYC1 A0A0D9RBZ3 A0A2I3HZY2 A0A2K5CRS7 A0A2K5KFQ7 A0A2K5NR44 A0A2K5PWS1 A0A2K5VC21 A0A2K6AL17 A0A2K6DKK6 A0A2K6P885 A0A2K6SX02 H2PNH8 H2QVD0 H9FUZ4 Q16656 U3CV73
ENSP00000223190 ENSP00000376922 ENSP00000376924 ENSP00000223190 ENSP00000376922 ENSP00000376924 9606.ENSP00000223190 ENSPTRP00000033713 NP_001035199.1.87134 NP_001035199.1.92137 NP_005002.3.87134 NP_005002.3.92137 XP_001155756.1.37143 XP_003261368.1.23891 XP_003261369.1.23891 XP_003813536.1.60992 XP_003951178.1.37143 XP_005550810.1.63531 XP_007981087.1.81039 XP_010341430.1.74449 XP_010341434.1.74449 XP_010377070.1.97406 XP_010377071.1.97406 XP_010377072.1.97406 XP_010377073.1.97406 XP_010377074.1.97406 XP_011722191.1.29376 XP_011722192.1.29376 XP_011794975.1.43180 XP_011851268.1.47321 XP_011943426.1.92194 XP_011943427.1.92194 XP_011943428.1.92194 XP_011943429.1.92194 XP_011943431.1.92194 XP_011943432.1.92194 XP_014990395.1.72884 XP_014990396.1.72884 XP_014990397.1.72884 XP_014990398.1.72884 XP_015303517.1.63531 XP_016813643.1.37143 XP_017388059.1.71028 XP_017388060.1.71028 XP_017388061.1.71028 XP_017388062.1.71028 XP_017388063.1.71028 XP_017388064.1.71028 XP_017388065.1.71028 XP_017388066.1.71028 XP_017388067.1.71028 XP_021529355.1.9421 XP_021529358.1.9421 ENSPANP00000018083 ENSPTRP00000033713 ENSPPYP00000020191 ENSNLEP00000015381 gi|93141037|ref|NP_005002.3| gi|93141039|ref|NP_001035199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]