SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015402 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015402
Domain Number 1 Region: 43-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-21
Family MAM domain 0.01
Further Details:      
 
Domain Number 2 Region: 238-340
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000665
Family MAM domain 0.036
Further Details:      
 
Domain Number 3 Region: 6-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015402   Gene: ENSNLEG00000012701   Transcript: ENSNLET00000016189
Sequence length 352
Comment pep:novel supercontig:Nleu1.0:GL397271.1:17760407:17843052:1 gene:ENSNLEG00000012701 transcript:ENSNLET00000016189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGQKGTESFQCDNGVSLPPDSICDFTDQCGDSSDERHCLNYERCDFEDGLCNMAEDQSLQ
PSWTKRNGMTGLSPPFYDHSGDVSAHFLSLVSRVDSISSSLRSRVFLPTNDQHDCQITFY
YFSSQVSGKLMVGLQTACGGPIQHLWQNTAALPNQWERNVIKIQSSQRFQVVFQGQMVST
YEQDEVIAIDDICFSSGCLPANDGILLCQEALNAEQELCHPDTDLCRFDATDEELSLCQA
CGFEFDMCEWTSETSAGRISWMRTKAREVPALESTPQRDQGGDDEGYYVWVGAKHAFTLN
HLDSRAYLNSSVCHCLGKSCHLQFYYAMESSVLRVRLYNNKVRRKFHLFQIH
Download sequence
Identical sequences ENSNLEP00000015402 ENSNLEP00000015402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]