SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015563 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015563
Domain Number 1 Region: 355-611
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.14e-78
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 194-303
Classification Level Classification E-value
Superfamily Kringle-like 1.74e-33
Family Kringle modules 0.00035
Further Details:      
 
Domain Number 3 Region: 36-90
Classification Level Classification E-value
Superfamily Kringle-like 5.24e-20
Family Fibronectin type II module 0.0039
Further Details:      
 
Domain Number 4 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000259
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015563
Domain Number - Region: 175-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015563   Gene: ENSNLEG00000012798   Transcript: ENSNLET00000016353
Sequence length 613
Comment pep:known_by_projection supercontig:Nleu1.0:GL397498.1:1132754:1140389:-1 gene:ENSNLEG00000012798 transcript:ENSNLET00000016353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLLLGFLLMSLESTLLIPPWKAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHK
CTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNTPSGPHCL
CPQHLTGKHCQREKCFEPQLLRFHENEIWYRSEQTAARCQYKGPDAHCQRLASQACRANP
CLHGGRCLEVEGHRLCHCPVGYTGPFCDVDTKASCYDGRGLSYRGLAKTTLSGAPCQPWA
SEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQAA
PPTPVSPRLHVPLMPPQPAPPKPQPTTRTPPQSQTPEALPAKREQPPSLTRNGPLSCGQR
LRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPED
LTVVLGQERHNHSCEQCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYV
QPVCLPSGAARPSETALCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGASI
LPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGVISWGSGCGDRNKPGVYTDV
AYYLAWIREHTVS
Download sequence
Identical sequences ENSNLEP00000015563 ENSNLEP00000015563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]