SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015581 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015581
Domain Number 1 Region: 353-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 2 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family EGF-type module 0.041
Further Details:      
 
Domain Number 3 Region: 409-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015581
Domain Number - Region: 24-65,104-166
Classification Level Classification E-value
Superfamily Sialidases 0.000147
Family Sialidases (neuraminidases) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015581   Gene: ENSNLEG00000012836   Transcript: ENSNLET00000016374
Sequence length 452
Comment pep:known_by_projection supercontig:Nleu1.0:GL397403.1:1857246:1931681:1 gene:ENSNLEG00000012836 transcript:ENSNLET00000016374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDNEEEGLATYWQSITWSRYPSPLE
ANXXXXXXKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACTCHAPGPHCECYGHSN
RCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDR
CNETGFCECREGAAGPKCDDCLPTHYWRQGCY
Download sequence
Identical sequences ENSNLEP00000015581 ENSNLEP00000015581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]