SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015584 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015584
Domain Number 1 Region: 298-561
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.14e-86
Family Eukaryotic proteases 0.000000000578
Further Details:      
 
Domain Number 2 Region: 105-210
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-32
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 3 Region: 213-301
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-31
Family Kringle modules 0.00000699
Further Details:      
 
Domain Number 4 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 2.82e-20
Family Fibronectin type I module 0.0000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015584   Gene: ENSNLEG00000012779   Transcript: ENSNLET00000016377
Sequence length 562
Comment pep:known_by_projection supercontig:Nleu1.0:GL397325.1:12437184:12540566:-1 gene:ENSNLEG00000012779 transcript:ENSNLET00000016377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAMKRGLCCVLLLCGAVFASPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTTATCYEDQGISYRGMWSTAESGAECTNWNSSALAQKPYSGRRPDAVRLGLGNHNYCR
NPDGDSKPWCYVFKAGKYSSEFCSTPACSKGNSDCYFGNGLAYRGTHSLTELGASCLPWN
SMILIGKVYTAQNPNAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHKRLPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRAVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNFLDWIHDNMRP
Download sequence
Identical sequences A0A2I3GC18
XP_003269679.1.23891 ENSNLEP00000015584 ENSNLEP00000015584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]