SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015731 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015731
Domain Number 1 Region: 19-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-62
Family Calnexin/calreticulin 0.0000523
Further Details:      
 
Domain Number 2 Region: 201-315
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.67e-46
Family P-domain of calnexin/calreticulin 0.000000604
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015731
Domain Number - Region: 310-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0839
Family Calnexin/calreticulin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015731   Gene: ENSNLEG00000012958   Transcript: ENSNLET00000016532
Sequence length 417
Comment pep:known_by_projection supercontig:Nleu1.0:GL397381.1:4190976:4196434:1 gene:ENSNLEG00000012958 transcript:ENSNLET00000016532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGITKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Download sequence
Identical sequences G1RR67
XP_003275645.1.23891 ENSNLEP00000015731 ENSNLEP00000015731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]